PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G004230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 232aa    MW: 23988.5 Da    PI: 4.5808
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G004230.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260348.5e-115610254100
                DUF260  54 redamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                            + +++sl+yeA+ r+ +Pv+G++g++++++++l+++++e++l++e+
  HL.SW.v1.0.G004230.1  56 VDLIFKSLLYEACGRIVNPVSGSTGLVQSGSWHLCEAAVEAVLRGEP 102
                           56789***********************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.4E-65696IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MAVESSDEAA PRAAPSDPAS TGSNPPNPNP TPLSSSPNST AAPDSSTSSM PAPSTVDLIF  60
KSLLYEACGR IVNPVSGSTG LVQSGSWHLC EAAVEAVLRG EPITPVSAEL APGSASVSGD  120
IRHAAKREGS VIRKVQSRRR LKRKVAKVEV QSETEFGTES AQLVLSGPPV SHDSEGTRQL  180
LSPGADSGEE DSGSVALAVK PKLGGVELEL TLGWAMWTFD KSERSEEEDA N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137143RRRLKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882967.17e-37PREDICTED: LOB domain-containing protein 40-like
TrEMBLA0A061G1V52e-36A0A061G1V5_THECC; LOB domain-containing protein 41, putative
STRINGVIT_17s0000g03720.t019e-33(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2539523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.14e-26LOB domain-containing protein 40